PDB entry 1pcv

View 1pcv on RCSB PDB site
Description: Crystal structure of osmotin, a plant antifungal protein
Class: antifungal protein
Keywords: PR-5 protein family, antifungal protein, thaumatin-like protein
Deposited on 2003-05-16, released 2004-02-17
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: osmotin
    Species: Nicotiana tabacum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pcva_
  • Chain 'B':
    Compound: osmotin
    Species: Nicotiana tabacum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pcvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pcvA (A:)
    atievrnncpytvwaastpigggrrldrgqtwvinaprgtkmarvwgrtncnfnaagrgt
    cqtgdcggvlqctgwgkppntlaeyaldqfsgldfwdislvdgfnipmtfaptnpsggkc
    haihctaningecprelrvpggcnnpcttfggqqycctqgpcgptffskffkqrcpdays
    ypqddptstftcpggstnyrvifcp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pcvB (B:)
    atievrnncpytvwaastpigggrrldrgqtwvinaprgtkmarvwgrtncnfnaagrgt
    cqtgdcggvlqctgwgkppntlaeyaldqfsgldfwdislvdgfnipmtfaptnpsggkc
    haihctaningecprelrvpggcnnpcttfggqqycctqgpcgptffskffkqrcpdays
    ypqddptstftcpggstnyrvifcp