PDB entry 1pcl

View 1pcl on RCSB PDB site
Description: unusual structural features in the parallel beta-helix in pectate lyases
Class: lyase (acting on polysaccharides)
Keywords: lyase (acting on polysaccharides)
Deposited on 1993-11-05, released 1995-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 1995-02-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pectate lyase e
    Species: Erwinia chrysanthemi
    Gene: PPEL748 OF PELC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1pcla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pclA (A:)
    avetdaattgwatqnggttggakaakavevknisdfkkalngtdssakiikvtgpidisg
    gkaytsfddqkarsqisipsnttiigvgsngkftngslvikgvknvilrnlyietpvdva
    phyesgdgwnaewdaavidnstnvwvdhvtisdgsftddkyttkdgekyvqhdgaldikk
    gsdyvtisysrfelhdktilighsdsngsqdsgklrvtfhnnvfdrvteraprvrfgsih
    aynnvylgdvkhsvypylysfglgtsgsilsesnsftlsnlksidgknpecsivkqfnsk
    vfsdkgslvngstttkldtcgltaykptlpykysaqtmtsslatsinnnagygkl