PDB entry 1pcl

View 1pcl on RCSB PDB site
Description: unusual structural features in the parallel beta-helix in pectate lyases
Deposited on 1993-11-05, released 1995-02-14
The last revision prior to the SCOP 1.69 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1pcl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pcl_ (-)
    avetdaattgwatqnggttggakaakavevknisdfkkalngtdssakiikvtgpidisg
    gkaytsfddqkarsqisipsnttiigvgsngkftngslvikgvknvilrnlyietpvdva
    phyesgdgwnaewdaavidnstnvwvdhvtisdgsftddkyttkdgekyvqhdgaldikk
    gsdyvtisysrfelhdktilighsdsngsqdsgklrvtfhnnvfdrvteraprvrfgsih
    aynnvylgdvkhsvypylysfglgtsgsilsesnsftlsnlksidgknpecsivkqfnsk
    vfsdkgslvngstttkldtcgltaykptlpykysaqtmtsslatsinnnagygkl