PDB entry 1pch

View 1pch on RCSB PDB site
Description: structural evidence for the evolutionary divergence of mycoplasma from gram-positive bacteria: the histidine-containing phosphocarrier protein
Deposited on 1995-07-11, released 1995-10-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1pch__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pch_ (-)
    akfsaiitdkvglharpasvlakeaskfssnitiianekqgnlksimnvmamaiktgtei
    tiqadgndadqaiqaikqtmidtaliqg