PDB entry 1pch

View 1pch on RCSB PDB site
Description: structural evidence for the evolutionary divergence of mycoplasma from gram-positive bacteria: the histidine-containing phosphocarrier protein
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1995-07-11, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphocarrier protein
  Species: Mycoplasma capricolum [TaxId:2095]
  Gene: PTSH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45611 (0-87)
  Domains in SCOPe 2.08: d1pcha_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pchA (A:)
  akfsaiitdkvglharpasvlakeaskfssnitiianekqgnlksimnvmamaiktgtei
  tiqadgndadqaiqaikqtmidtaliqg