PDB entry 1pcg

View 1pcg on RCSB PDB site
Description: Helix-stabilized cyclic peptides as selective inhibitors of steroid receptor-coactivator interactions
Class: transcription/inhibitor
Keywords: co-activator binding site, TRANSCRIPTION-INHIBITOR COMPLEX
Deposited on 2003-05-16, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-243)
      • engineered (77)
      • engineered (113)
      • engineered (226)
    Domains in SCOPe 2.07: d1pcga_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-243)
      • engineered (77)
      • engineered (113)
      • engineered (226)
    Domains in SCOPe 2.07: d1pcgb_
  • Chain 'E':
    Compound: peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1PCG (0-8)
  • Chain 'F':
    Compound: peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1PCG (0-8)
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pcgA (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pcgA (A:)
    nslalsltadqmvsalldaeppilyseydptpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflhihrvldkitdtlihlmakagl
    tlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemldah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pcgB (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pcgB (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydllleml
    dah
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.