PDB entry 1pce

View 1pce on RCSB PDB site
Description: solution structure and dynamics of pec-60, a protein of the kazal type inhibitor family, determined by nuclear magnetic resonance spectroscopy
Deposited on 1994-02-22, released 1994-04-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1pce__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pce_ (-)
    ekqvfsrmpicehmtespdcsriydpvcgtdgvtyesecklclarienkqdiqivkdgec