PDB entry 1pca

View 1pca on RCSB PDB site
Description: three dimensional structure of porcine pancreatic procarboxypeptidase a. a comparison of the a and b zymogens and their determinants for inhibition and activation
Class: hydrolase(c-terminal peptidase)
Keywords: hydrolase(c-terminal peptidase)
Deposited on 1991-10-28, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: procarboxypeptidase a pcpa
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09954 (97-402)
      • conflict (97)
      • conflict (125)
      • conflict (134)
      • conflict (151)
      • conflict (160)
      • conflict (168)
      • conflict (183)
      • conflict (187-189)
      • conflict (196-197)
      • conflict (208)
      • conflict (216)
      • conflict (219)
      • conflict (226-227)
      • conflict (231)
      • conflict (235)
      • conflict (237)
      • conflict (253)
      • conflict (256)
      • conflict (263)
      • conflict (274)
      • conflict (278-280)
      • conflict (305-306)
      • conflict (311)
      • conflict (314)
      • conflict (317)
      • conflict (325)
      • conflict (331-333)
      • conflict (340)
      • conflict (348)
      • conflict (371)
      • conflict (401-402)
    Domains in SCOPe 2.07: d1pcaa1, d1pcaa2
  • Heterogens: ZN, CIT, VAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pcaA (A:)
    kkedfvghqvlrisvddeaqvqkvkeledlehlqldfwrgparpgfpidvrvpfpsiqav
    kvfleahgirytimiedvqllldeeqeqmfasqgrarttstfnyatyhtleeiydfmdil
    vaehpalvsklqigrsyegrpiyvlkfstggsnrpaiwidsgihsrewitqasgvwfakk
    itenygqnssftaildsmdifleivtnpngfafthsdnrlwrktrskasgslcvgsdsnr
    nwdagfggagassspcaetyhgkypnsevevksitdfvknngnikafisihsysqlllyp
    ygyktqspadkselnqiaksavaalkslygtsykygsiitviyqasggvidwtynqgiky
    sfsfelrdtgrrgfllpasqiiptaqetwlalltimehtlnns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pcaA (A:)
    kedfvghqvlrisvddeaqvqkvkeledlehlqldfwrgparpgfpidvrvpfpsiqavk
    vfleahgirytimiedvqllldeeqeqmfasqgrarttstfnyatyhtleeiydfmdilv
    aehpalvsklqigrsyegrpiyvlkfstggsnrpaiwidsgihsrewitqasgvwfakki
    tenygqnssftaildsmdifleivtnpngfafthsdnrlwrktrskasgslcvgsdsnrn
    wdagfggagassspcaetyhgkypnsevevksitdfvknngnikafisihsysqlllypy
    gyktqspadkselnqiaksavaalkslygtsykygsiitviyqasggvidwtynqgikys
    fsfelrdtgrrgfllpasqiiptaqetwlalltimehtlnns