PDB entry 1pc9

View 1pc9 on RCSB PDB site
Description: Crystal Structure of BnSP-6, a Lys49-Phospholipase A2
Class: hydrolase
Keywords: Lys49-phospholipase A2, myotoxin, crystal structure, Bothrops, venom., HYDROLASE
Deposited on 2003-05-16, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.186
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BnSP-6
    Species: Bothrops neuwiedi pauloensis [TaxId:95649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pc9a_
  • Chain 'B':
    Compound: BnSP-6
    Species: Bothrops neuwiedi pauloensis [TaxId:95649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pc9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pc9A (A:)
slfelgkmilqetgknpaksygaygcncgvlgrggpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pc9B (B:)
slfelgkmilqetgknpaksygaygcncgvlgrggpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c