PDB entry 1pc8

View 1pc8 on RCSB PDB site
Description: crystal structure of a novel form of mistletoe lectin from himalayan viscum album l. at 3.8a resolution
Deposited on 2003-05-16, released 2004-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.231
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pc8A (A:)
    yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
    ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
    kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
    lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pc8B (B:)
    csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
    lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
    dytlgqgwlagndtaprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpe
    qnqdqcltsgrdsvaginivscsggssgqrwvftnegailnlknglamdvanpglgqiii
    ypatgkpnqmwlpvp