PDB entry 1pc8

View 1pc8 on RCSB PDB site
Description: Crystal Structure of a novel form of mistletoe lectin from Himalayan Viscum album L. at 3.8A resolution
Class: hydrolase
Keywords: Novel form, mistletoe lectin, HYDROLASE
Deposited on 2003-05-16, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Himalayan mistletoe ribosome-inactivating protein
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • GB AAT37532 (0-239)
    Domains in SCOPe 2.08: d1pc8a_
  • Chain 'B':
    Compound: Himalayan mistletoe ribosome-inactivating protein
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • GB AAT37532 (0-254)
    Domains in SCOPe 2.08: d1pc8b1, d1pc8b2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pc8A (A:)
    yerldldvtsqttgeeyfrfitllrdyvssgsfsneipllrqsgggveaarfvlveltne
    ggdsitaaidvtnlyvvayqagsqsyflsgpgthlftgttrsslpfngsypdleqyaghr
    kqiplgidqliqsvtalrfpgntrtqarsililiqmiseaarfnpilwrarqyinsgasf
    lpdvymleletswgqqstqvqqstegvfnnpirlaipgnfvtltnvrdviaslaimlfvc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pc8B (B:)
    csaseptvrivgrngmnvdvrdddfhdgnqiqlwpsksnndpnqlwtikrdgtirsngsc
    lttygytagvyvmifdcntavreatiwqiwgngtiinprsnlalaassgikgttltvqtl
    dytlgqgwlagndtaprevtiygfndlcmesnggsvwvetcvsqqndrwalygdgsirpe
    qnqdqcltsgrdsvaginivscsggssgqrwvftnegailnlknglamdvanpglgqiii
    ypatgkpnqmwlpvp