PDB entry 1pc5

View 1pc5 on RCSB PDB site
Description: Crystal Structure of the P50G Mutant of Ferredoxin I at 1.8 A Resolution
Class: electron transport
Keywords: electron transport, iron-sulfur protein, ferredoxin, mutant
Deposited on 2003-05-15, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (Start-106)
      • engineered (50)
    Domains in SCOPe 2.07: d1pc5a_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pc5A (A:)
    mafvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecgaqaifsede
    vpedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pc5A (A:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecgaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler