PDB entry 1pc0

View 1pc0 on RCSB PDB site
Description: NMR Structure of the Archaeal Homologue of RNase P Protein Rpp29
Class: RNA binding protein
Keywords: sandwich, beta-sheet
Deposited on 2003-05-15, released 2003-12-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-12-09, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AF1917
    Species: Archaeoglobus fulgidus
    Gene: AF1917
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1pc0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pc0A (A:)
    glmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfrvwykgkimrikg
    d