PDB entry 1pc0

View 1pc0 on RCSB PDB site
Description: NMR Structure of the Archaeal Homologue of RNase P Protein Rpp29
Class: RNA binding protein
Keywords: sandwich, beta-sheet
Deposited on 2003-05-15, released 2003-12-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-09, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein AF1917
  Species: Archaeoglobus fulgidus
  Gene: AF1917
  Database cross-references and differences (RAF-indexed):
  • Uniprot O28362 (0-60)
  Domains in SCOP 1.73: d1pc0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pc0A (A:)
  glmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfrvwykgkimrikg
  d