PDB entry 1pc0

View 1pc0 on RCSB PDB site
Description: NMR Structure of the Archaeal Homologue of RNase P Protein Rpp29
Deposited on 2003-05-15, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pc0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pc0A (A:)
    glmvevvespnhsevgikgevvdetqntlkimtekglkvvakrgrtfrvwykgkimrikg
    d