PDB entry 1pby

View 1pby on RCSB PDB site
Description: structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution
Deposited on 2003-05-15, released 2003-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-09, with a file datestamp of 2003-09-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbyA (A:)
    vtgeevlqnacaachvqhedgrweridaarktpegwdmtvtrmmrnhgvalepeeraaiv
    rhlsdtrglslaeteerryilerepvawdegpdtsmtqtcgrchsyarvalqrrtpedwk
    hlvnfhlgqfptleyqalardrdwwgiaqaeiipflartyplgeapdayaddasgayvla
    grqpgrgdytgrlvlkkagedyevtmtldfadgsrsfsgtgrilgagewratlsdgtvti
    rqifalqdgrfsgrwhdadsdviggrlaavkadaapqvlavaparlkigeetqlrvagtg
    lgsdltlpegvagsvesagngvtvlkltatgtpgpvslelggqkvdlvaydrpdrisivp
    dltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswatdnfdeeaek
    mqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegeplsaeahlyatv
    qrfvdapir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbyB (B:)
    rdyilaparpdklvvidtekmavdkvitiadagptpmvpmvapggriayatvnkseslvk
    idlvtgetlgridlstpeervkslfgaalspdgktlaiyespvrlelthfevqptrvaly
    daetlsrrkafeaprqitmlawardgsklyglgrdlhvmdpeagtlvedkpiqsweaety
    aqpdvlavwnqhessgvmatpfytarkdidpadptayrtglltmdletgemamrevrimd
    vfyfstavnpaktrafgaynvlesfdleknasikrvplphsyysvnvstdgstvwlggal
    gdlaaydaetlekkgqvdlpgnasmslasvrlftrde
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbyC (C:)
    mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwwpaqvadtlntypnwsag
    addvmqdwrklqsvfpetk