PDB entry 1pby

View 1pby on RCSB PDB site
Description: Structure of the Phenylhydrazine Adduct of the Quinohemoprotein Amine Dehydrogenase from Paracoccus denitrificans at 1.7 A Resolution
Class: oxidoreductase
Keywords: quinohemoprotein, amine dehydrogenase, oxidoreductase
Deposited on 2003-05-15, released 2003-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinohemoprotein amine dehydrogenase 60 kDa subunit
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pbya1, d1pbya2, d1pbya3, d1pbya4, d1pbya5
  • Chain 'B':
    Compound: quinohemoprotein amine dehydrogenase 40 kDa subunit
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • GB BAB78729 (0-336)
    Domains in SCOPe 2.07: d1pbyb_
  • Chain 'C':
    Compound: quinohemoprotein amine dehydrogenase 9 kDa subunit
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • GB BAB78728 (0-78)
      • modified residue (42)
    Domains in SCOPe 2.07: d1pbyc_
  • Heterogens: HEM, TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbyA (A:)
    vtgeevlqnacaachvqhedgrweridaarktpegwdmtvtrmmrnhgvalepeeraaiv
    rhlsdtrglslaeteerryilerepvawdegpdtsmtqtcgrchsyarvalqrrtpedwk
    hlvnfhlgqfptleyqalardrdwwgiaqaeiipflartyplgeapdayaddasgayvla
    grqpgrgdytgrlvlkkagedyevtmtldfadgsrsfsgtgrilgagewratlsdgtvti
    rqifalqdgrfsgrwhdadsdviggrlaavkadaapqvlavaparlkigeetqlrvagtg
    lgsdltlpegvagsvesagngvtvlkltatgtpgpvslelggqkvdlvaydrpdrisivp
    dltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswatdnfdeeaek
    mqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegeplsaeahlyatv
    qrfvdapir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbyB (B:)
    rdyilaparpdklvvidtekmavdkvitiadagptpmvpmvapggriayatvnkseslvk
    idlvtgetlgridlstpeervkslfgaalspdgktlaiyespvrlelthfevqptrvaly
    daetlsrrkafeaprqitmlawardgsklyglgrdlhvmdpeagtlvedkpiqsweaety
    aqpdvlavwnqhessgvmatpfytarkdidpadptayrtglltmdletgemamrevrimd
    vfyfstavnpaktrafgaynvlesfdleknasikrvplphsyysvnvstdgstvwlggal
    gdlaaydaetlekkgqvdlpgnasmslasvrlftrde
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbyC (C:)
    mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwwpaqvadtlntypnwsag
    addvmqdwrklqsvfpetk