PDB entry 1pbx

View 1pbx on RCSB PDB site
Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative
Deposited on 1991-11-04, released 1992-10-15
The last revision prior to the SCOP 1.63 freeze date was dated 1992-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1pbxa_
  • Chain 'B':
    Domains in SCOP 1.63: d1pbxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbxA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pbxB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh