PDB entry 1pbw

View 1pbw on RCSB PDB site
Description: structure of bcr-homology (bh) domain
Class: phosphotransferase
Keywords: phosphotransferase, tpase activating protein, gap, cdc42, phosphoinositide 3-kinase, sh3 domain, sh2 domain, signal transduction
Deposited on 1996-10-17, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pbwa_
  • Chain 'B':
    Compound: phosphatidylinositol 3-kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pbwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pbwA (A:)
    meadveqqaltlpdlaeqfappdiapplliklveaiekkglecstlyrtqsssnlaelrq
    lldcdtpsvdlemidvhvladafkrylldlpnpvipaavysemislapevqsseeyiqll
    kklirspsiphqywltlqyllkhffklsqtssknllnarvlseifspmlfrfsaassdnt
    enlikvieilistewnerqpapalppkppkpttvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pbwA (A:)
    lpdlaeqfappdiapplliklveaiekkglecstlyrtqsssnlaelrqlldcdtpsvdl
    emidvhvladafkrylldlpnpvipaavysemislapevqsseeyiqllkklirspsiph
    qywltlqyllkhffklsqtssknllnarvlseifspmlfrfsaassdntenlikvieili
    stew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pbwB (B:)
    meadveqqaltlpdlaeqfappdiapplliklveaiekkglecstlyrtqsssnlaelrq
    lldcdtpsvdlemidvhvladafkrylldlpnpvipaavysemislapevqsseeyiqll
    kklirspsiphqywltlqyllkhffklsqtssknllnarvlseifspmlfrfsaassdnt
    enlikvieilistewnerqpapalppkppkpttvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pbwB (B:)
    lpdlaeqfappdiapplliklveaiekkglecstlyrtqsssnlaelrqlldcdtpsvdl
    emidvhvladafkrylldlpnpvipaavysemislapevqsseeyiqllkklirspsiph
    qywltlqyllkhffklsqtssknllnarvlseifspmlfrfsaassdntenlikvieili
    stewnerqpapalpp