PDB entry 1pbv

View 1pbv on RCSB PDB site
Description: sec7 domain of the exchange factor arno
Class: exchange factor
Keywords: exchange factor, sec7, arno, arf functional class: guanine nucleotide exchange factor
Deposited on 1998-01-15, released 1999-03-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: arno
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99418 (0-194)
  Domains in SCOPe 2.03: d1pbva_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pbvA (A:)
  anegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktai
  gdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqry
  clcnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeell
  rnlydsirnepfkip