PDB entry 1pbt

View 1pbt on RCSB PDB site
Description: The crystal structure of TM1154, oxidoreductase, sol/devB family from Thermotoga maritima
Class: hydrolase, oxidoreductase
Keywords: Structural genomics, alpha-beta, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE, OXIDOREDUCTASE
Deposited on 2003-05-15, released 2003-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.179
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconolactonase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0N8 (22-241)
      • modified residue (22)
      • modified residue (46)
      • modified residue (154)
    Domains in SCOPe 2.08: d1pbta_
  • Heterogens: SO4, TRS, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pbtA (A:)
    mgsshhhhhhssgrenlyfqghmektviylledgyvdfvvekirtkmeklleekdkifvv
    laggrtplpvyeklaeqkfpwnrihfflsderyvpldsdqsnfrninevlfsrakipsgn
    vhyvdtslpiekacekyereirsatdqfdlailgmgpdghvasifdletgnkdnlvtftd
    psgdpkvprvtltfralntslyvlflirgkekinrlteilkdtplpayfvrgkektvwfv
    gkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pbtA (A:)
    mektviylledgyvdfvvekirtkmeklleekdkifvvlaggrtplpvyeklaeqkfpwn
    rihfflsderyvpldsdqsnfrninevlfsrakipsgnvhyvdtslpiekacekyereir
    satdqfdlailgmgpdghvasifdletgnkdnlvtftdpsgdpkvprvtltfralntsly
    vlflirgkekinrlteilkdtplpayfvrgkektvwfvgk