PDB entry 1pbn

View 1pbn on RCSB PDB site
Description: purine nucleoside phosphorylase
Class: pentosyltransferase
Keywords: purine nucleoside phosphorylase
Deposited on 1995-07-10, released 1995-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55859 (0-288)
      • conflict (1)
      • conflict (248)
    Domains in SCOP 1.73: d1pbna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pbnA (A:)
mangytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
npnfevgdimlirdhinlpgfsgenplrgpneerfgvrfpamsdaydrdmrqkahstwkq
mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasipvsghtg