PDB entry 1pbj

View 1pbj on RCSB PDB site
Description: CBS domain protein
Class: Structural genomics, unknown function
Keywords: Structural genomics, Methanothermobacter thermautotrophicus, CBS domain, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on 2003-05-14, released 2003-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pbja3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pbjA (A:)
    mrvedvmvtdvdtiditasledvlrnyvenakgssvvvkegvrvgivttwdvleaiaegd
    dlaevkvwevmerdlvtispratikeaaekmvknvvwrllveeddeiigvisatdilrak
    makry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pbjA (A:)
    rvedvmvtdvdtiditasledvlrnyvenakgssvvvkegvrvgivttwdvleaiaegdd
    laevkvwevmerdlvtispratikeaaekmvknvvwrllveeddeiigvisatdilrakm