PDB entry 1pbg

View 1pbg on RCSB PDB site
Description: the three-dimensional structure of 6-phospho-beta galactosidase from lactococcus lactis
Deposited on 1995-09-14, released 1996-03-08
The last revision prior to the SCOP 1.63 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.164
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1pbga_
  • Chain 'B':
    Domains in SCOP 1.63: d1pbgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pbgA (A:)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
    vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
    wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pbgA (A:)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiikyqikgvgrrvapdyvprwiiypeglydqimrvkndypnykkiyit
    englgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfiwslmdvfswsngye
    kryglfyvdfdtqerypkksahwykklaetqvie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pbgB (B:)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
    vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
    wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pbgB (B:)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiihskyqikgvgrrvapdyvprwiiypeglydqimrvkndypnykkiy
    itenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfiwslmdvfswsng
    yekryglfyvdfdtqerypkksahwykklaetqvie