PDB entry 1pba

View 1pba on RCSB PDB site
Description: the nmr structure of the activation domain isolated from porcine procarboxypeptidase b
Deposited on 1991-11-18, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1pba__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pba_ (-)
  hhsgehfegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaed
  ilavedfleqnelqyevlinn