PDB entry 1pba

View 1pba on RCSB PDB site
Description: the nmr structure of the activation domain isolated from porcine procarboxypeptidase b
Class: hydrolase(c-terminal peptidase)
Keywords: hydrolase(c-terminal peptidase)
Deposited on 1991-11-18, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Procarboxypeptidase B
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09955 (0-80)
  Domains in SCOPe 2.08: d1pbaa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pbaA (A:)
  hhsgehfegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaed
  ilavedfleqnelqyevlinn