PDB entry 1pb6

View 1pb6 on RCSB PDB site
Description: Crystal structure of hypothetical transcriptional regulator ycdC
Class: transcription
Keywords: Helix-loop-helix, hypothetical transcriptional regulator, dimer, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSCRIPTION
Deposited on 2003-05-14, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical transcriptional regulator ycdC
    Species: Escherichia coli [TaxId:562]
    Gene: ycdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pb6a3, d1pb6a4
  • Chain 'B':
    Compound: Hypothetical transcriptional regulator ycdC
    Species: Escherichia coli [TaxId:562]
    Gene: ycdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pb6b3, d1pb6b4
  • Chain 'C':
    Compound: Hypothetical transcriptional regulator ycdC
    Species: Escherichia coli [TaxId:562]
    Gene: ycdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pb6c3, d1pb6c4
  • Chain 'D':
    Compound: Hypothetical transcriptional regulator ycdC
    Species: Escherichia coli [TaxId:562]
    Gene: ycdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pb6d3, d1pb6d4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pb6A (A:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pb6A (A:)
    avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
    diwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdl
    kalideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevff
    nqtvenvqriiiegirpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pb6B (B:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pb6B (B:)
    avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
    diwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdl
    kalideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevff
    nqtvenvqriiiegirpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pb6C (C:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pb6C (C:)
    avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
    diwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdl
    kalideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevff
    nqtvenvqriiiegirpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pb6D (D:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pb6D (D:)
    avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
    diwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdl
    kalideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevff
    nqtvenvqriiiegirpr