PDB entry 1pb1

View 1pb1 on RCSB PDB site
Description: A four location model to explain the stereospecificity of proteins.
Class: oxidoreductase
Keywords: l-isocitrate, isocitrate dehydrogenase, enantiomer, specificity, stereospecificity, OXIDOREDUCTASE
Deposited on 2003-05-14, released 2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Escherichia coli [TaxId:562]
    Gene: ICD OR ICDA OR ICDE OR B1136
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pb1a_
  • Heterogens: SO4, ICT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pb1A (A:)
    meskvvvpaqgkkitlqngklnvpenpiipyiegdgigvdvtpamlkvvdaavekaykge
    rkiswmeiytgekstqvygqdvwlpaetldlireyrvaikgplttpvgggirslnvalrq
    eldlyiclrpvryyqgtpspvkhpeltdmvifrensediyagiewkadsadaekvikflr
    eemgvkkirfpehcgigikpcseegtkrlvraaieyaiandrdsvtlvhkgnimkftega
    fkdwgyqlareefggelidggpwlkvknpntgkeivikdviadaflqqillrpaeydvia
    cmnlngdyisdalaaqvggigiapganigdecalfeathgtapkyagqdkvnpgsiilsa
    emmlrhmgwteaadlivkgmegainaktvtydferlmdgakllkcsefgdaiienm