PDB entry 1paz

View 1paz on RCSB PDB site
Description: refinement of the structure of pseudoazurin from alcaligenes faecalis s-6 at 1.55 angstroms resolution
Deposited on 1988-06-28, released 1988-10-09
The last revision prior to the SCOP 1.57 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 1.55 Å
R-factor: 0.18
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1paz__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1paz_ (-)
  enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
  nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia