PDB entry 1paz

View 1paz on RCSB PDB site
Description: refinement of the structure of pseudoazurin from alcaligenes faecalis s-6 at 1.55 angstroms resolution
Class: electron transfer(cuproprotein)
Keywords: electron transfer(cuproprotein)
Deposited on 1988-06-28, released 1988-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin precursor
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1paza_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pazA (A:)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
    sak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pazA (A:)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia