PDB entry 1pav

View 1pav on RCSB PDB site
Description: solution nmr structure of hypothetical protein ta1414 of thermoplasma acidophilum
Deposited on 2003-05-14, released 2003-05-27
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-27, with a file datestamp of 2003-05-27.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1pava_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pavA (A:)
  mdvkpdrvidargsycpgplmelikaykqakvgevisvystdagtkkdapawiqksgqel
  vgvfdrngyyeivmkkvk