PDB entry 1paq

View 1paq on RCSB PDB site
Description: crystal structure of the catalytic fragment of eukaryotic initiation factor 2b epsilon
Deposited on 2003-05-14, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.243
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1paqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1paqA (A:)
    msvnsiytdreeidsefededfekegiatveramennhdldtallelntlrmsmnvtyhe
    vriatitallrrvyhfiatqtlgpkdavvkvfnqwgllfkrqafdeeeyidlmniimeki
    veqsfdkpdlilfsalvslydndiieedviykwwdnvstdprydevkkltvkwvewlqna
    deessseee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1paqA (A:)
    dfekegiatveramennhdldtallelntlrmsmnvtyhevriatitallrrvyhfiatq
    tlgpkdavvkvfnqwgllfkrqafdeeeyidlmniimekiveqsfdkpdlilfsalvsly
    dndiieedviykwwdnvstdprydevkkltvkwvewlqnad