PDB entry 1paq

View 1paq on RCSB PDB site
Description: crystal structure of the catalytic fragment of eukaryotic initiation factor 2b epsilon
Class: translation
Keywords: heat repeat, aa motif, TRANSLATION
Deposited on 2003-05-14, released 2004-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.243
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor eIF-2B epsilon subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GCD6 OR TIF225 OR YDR211W OR YD8142.12 OR YD8142B.03
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32501
      • modified residue (33)
      • modified residue (51)
      • modified residue (53)
      • modified residue (112)
      • modified residue (116)
    Domains in SCOPe 2.08: d1paqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1paqA (A:)
    msvnsiytdreeidsefededfekegiatveramennhdldtallelntlrmsmnvtyhe
    vriatitallrrvyhfiatqtlgpkdavvkvfnqwgllfkrqafdeeeyidlmniimeki
    veqsfdkpdlilfsalvslydndiieedviykwwdnvstdprydevkkltvkwvewlqna
    deessseee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1paqA (A:)
    dfekegiatveramennhdldtallelntlrmsmnvtyhevriatitallrrvyhfiatq
    tlgpkdavvkvfnqwgllfkrqafdeeeyidlmniimekiveqsfdkpdlilfsalvsly
    dndiieedviykwwdnvstdprydevkkltvkwvewlqnad