PDB entry 1pae

View 1pae on RCSB PDB site
Description: nucleoside diphosphate kinase
Class: transferase
Keywords: selenocysteine selenomethionine, TRANSFERASE
Deposited on 2003-05-14, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.188
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Nucleoside diphosphate kinase, cytosolic
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: ndk
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • modified residue (79)
      • modified residue (93)
      • engineered (121)
    Domains in SCOPe 2.07: d1paex_
  • Heterogens: SE, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1paeX (X:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iagsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1paeX (X:)
    kertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpffgg
    lvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiagsdsv
    esanreialwfkpeelltevkpnpnlye