PDB entry 1pad

View 1pad on RCSB PDB site
Description: Binding of chloromethyl ketone substrate analogues to crystalline papain
Class: hydrolase/hydrolase inhibitor
Keywords: sulfhydryl proteinase, hydrolase-hydrolase inhibitor complex
Deposited on 1976-11-01, released 1977-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • conflict (46)
      • conflict (117)
      • conflict (134)
    Domains in SCOPe 2.08: d1pada_
  • Chain 'I':
    Compound: acetyl-ala-ala-phe-ala-chloromethylketone inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1PAD (Start-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1padA (A:)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
    llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn
    

  • Chain 'I':
    No sequence available.