PDB entry 1pa9

View 1pa9 on RCSB PDB site
Description: Yersinia Protein-Tyrosine Phosphatase complexed with pNCS (Yop51,Pasteurella X,Ptpase,Yop51delta162) (Catalytic Domain, Residues 163-468) Mutant With Cys 235 Replaced By Arg (C235r)
Class: hydrolase
Keywords: hydrolase, virulence
Deposited on 2003-05-13, released 2003-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase yoph
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: YOPH OR YOP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-283)
      • engineered (50)
    Domains in SCOPe 2.06: d1pa9a_
  • Heterogens: CSN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pa9A (A:)
    tvspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradl
    nanyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrq
    sgtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssev
    tkalaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrn
    sqlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pa9A (A:)
    vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
    anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
    gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
    kalaslvdqtaetkrnmyeskgsddsklrpvihcragvgrtaqligamcmndsrnsqlsv
    edmvsqmrvqrngimvqkdeqldvliklaegqgrpllns