PDB entry 1pa9

View 1pa9 on RCSB PDB site
Description: yersinia protein-tyrosine phosphatase complexed with pncs (yop51, pasteurella x,ptpase,yop51delta162) (catalytic domain, residues 163- 468) mutant with cys 235 replaced by arg (c235r)
Deposited on 2003-05-13, released 2003-11-04
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pa9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pa9A (A:)
    tvspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradl
    nanyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrq
    sgtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssev
    tkalaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrn
    sqlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pa9A (A:)
    vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
    anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
    gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
    kalaslvdqtaetkrnmyeskgsddsklrpvihcragvgrtaqligamcmndsrnsqlsv
    edmvsqmrvqrngimvqkdeqldvliklaegqgrpllns