PDB entry 1pa7

View 1pa7 on RCSB PDB site
Description: Crystal structure of amino-terminal microtubule binding domain of EB1
Class: structural protein
Keywords: CH domain, STRUCTURAL PROTEIN
Deposited on 2003-05-13, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.174
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EB1 (amino acids 1-130)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pa7a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pa7A (A:)
    mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkk
    vkfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanyd
    gkdydpvaar