PDB entry 1pa4

View 1pa4 on RCSB PDB site
Description: solution structure of a putative ribosome-binding factor from mycoplasma pneumoniae (mpn156)
Deposited on 2003-05-13, released 2004-03-02
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pa4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1pa4A (A:)
masykkerlendiirlinrtviheiynetvktghvthvklsddllhvtvyldcynreqid
rvvgafnqakgvfsrvlahnlylakavqihfvkdkaidnamriesiinslkkskpn

    Sequence, based on observed residues (ATOM records): (download) 
    >1pa4A (A:)
kerlendiirlinrtviheiynetvktghvthvklsddllhvtvyldcynreqidrvvga
fnqakgvfsrvlahnlylakavqihfvkdkaidnam