PDB entry 1pa0

View 1pa0 on RCSB PDB site
Description: crystal structure of bnsp-7, a lys49-phospholipase a2
Class: hydrolase
Keywords: Lys49-phospholipase A2, myotoxin, crystal structure, bothropic venom, HYDROLASE
Deposited on 2003-05-13, released 2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myotoxic phospholipase A2-like
    Species: Bothrops neuwiedi pauloensis [TaxId:95649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IAT9 (0-110)
      • see remark 999 (34)
    Domains in SCOPe 2.08: d1pa0a_
  • Chain 'B':
    Compound: Myotoxic phospholipase A2-like
    Species: Bothrops neuwiedi pauloensis [TaxId:95649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9IAT9 (0-110)
      • see remark 999 (34)
    Domains in SCOPe 2.08: d1pa0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pa0A (A:)
    slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pa0B (B:)
    slfelgkmilqetgknpaksygaygcncgvlgrgqpkdatdrccyvhkccykkltgcdpk
    kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
    c