PDB entry 1p9v

View 1p9v on RCSB PDB site
Description: x-ray structure of ydde_ecoli northeast structural genomics consortium target et25.
Class: structural genomics, unknown function
Keywords: unknown function
Deposited on 2003-05-12, released 2003-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-02-24, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yddE
    Species: Escherichia coli
    Gene: YDDE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37757 (12-307)
      • his tag (0-11)
      • modified residue (45)
      • modified residue (175)
      • modified residue (222)
      • modified residue (242)
      • modified residue (274)
      • his tag (308-309)
    Domains in SCOPe 2.07: d1p9va3, d1p9va4, d1p9va5, d1p9va6
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p9vA (A:)
sgrenlyfqghmkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetaf
llhsddsdvriryftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiek
hnddyrisleqgtpgfepplegetraaiinalhlteddilpglpiqvattghskvmiplk
pevdidalspdlnaltaiskkigcngffpfqirpgknetdgrmfspaigivedpvtgnan
gpmgawlvhhnvlphdgnvlrvkghqgralgrdgmievtvtirdnqpekvtisgtavilf
haewaielgs