PDB entry 1p9k

View 1p9k on RCSB PDB site
Description: the solution structure of ybcj from e. coli reveals a recently discovered alfal motif involved in rna-binding
Deposited on 2003-05-12, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1p9ka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p9kA (A:)
  gsmihrmsnmatfslgkhphvelcdllklegwsesgaqakiaiaegqvkvdgavetrkrc
  kivagqtvsfaghsvqvva