PDB entry 1p9k

View 1p9k on RCSB PDB site
Description: the solution structure of ybcj from e. coli reveals a recently discovered alfal motif involved in RNA-binding
Class: RNA binding protein
Keywords: alfaL motif, RNA-binding protein, E.coli, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 2003-05-12, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf, hypothetical protein
    Species: Escherichia coli [TaxId:83333]
    Gene: ybcJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AAS7 (2-78)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1p9ka1, d1p9ka2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p9kA (A:)
    gsmihrmsnmatfslgkhphvelcdllklegwsesgaqakiaiaegqvkvdgavetrkrc
    kivagqtvsfaghsvqvva