PDB entry 1p9h

View 1p9h on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE COLLAGEN-BINDING DOMAIN OF YERSINIA ADHESIN YadA
Class: cell adhesion
Keywords: collagen-binding, left-handed beta-roll, CELL ADHESION
Deposited on 2003-05-12, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.196
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invasin
    Species: Yersinia enterocolitica [TaxId:630]
    Gene: YADA OR YOPA OR INVA OR YOP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p9ha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p9hA (A:)
    mrgshhhhhhddydgipnltavqispnadpalgleypvrppvpgagglnasakgihsiai
    gataeaakgaavavgagsiatgvnsvaigplskalgdsavtygaastaqkdgvaigaras
    tsdtgvavgfnskadaknsvaighsshvaanhgysiaigdrsktdrensvsigheslnrq
    lthlaagtkdtdavnvaqlkkeiektqentnkrsaellananayad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p9hA (A:)
    pnltavqispnadpalgleyglnasakgihsiaigataeaakgaavavgagsiatgvnsv
    aigplskalgdsavtygaastaqkdgvaigarastsdtgvavgfnskadaknsvaighss
    hvaanhgysiaigdrsktdrensvsigheslnrqlthlaagtkdtdavnvaqlkkeiek