PDB entry 1p9e

View 1p9e on RCSB PDB site
Description: Crystal Structure Analysis of Methyl Parathion Hydrolase from Pseudomonas sp WBC-3
Class: hydrolase
Keywords: ZN Containing, hydrolase
Deposited on 2003-05-11, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyl Parathion Hydrolase
    Species: Pseudomonas sp. [TaxId:165468]
    Database cross-references and differences (RAF-indexed):
    • GB AAP06948
    Domains in SCOPe 2.07: d1p9ea_
  • Chain 'B':
    Compound: Methyl Parathion Hydrolase
    Species: Pseudomonas sp. [TaxId:165468]
    Database cross-references and differences (RAF-indexed):
    • GB AAP06948
    Domains in SCOPe 2.07: d1p9eb_
  • Heterogens: ZN, CD, K, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p9eA (A:)
    mplknrllarlscvaavvaataavapltlvstahaaapqvrtsapgyyrmllgdfeital
    sdgtvalpvdkrlnqpapktqsalaksfqkapletsvtgylvntgsklvlvdtgaaglfg
    ptlgrlaanlkaagyqpeqvdeiyithmhpdhvgglmvgeqlafpnavvradqkeadfwl
    sqtnldkapddeskgffkgamaslnpyvkagkfkpfsgntdlvpgikalashghtpghtt
    yvvesqgqklallgdlilvaavqfddpsvttqldsdsksvaverkkafadaakggyliaa
    shlsfpgighiraegkgyrfvpvnysvvnpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p9eA (A:)
    aapqvrtsapgyyrmllgdfeitalsdgtvalpvdkrlnqpapktqsalaksfqkaplet
    svtgylvntgsklvlvdtgaaglfgptlgrlaanlkaagyqpeqvdeiyithmhpdhvgg
    lmvgeqlafpnavvradqkeadfwlsqtnldkapddeskgffkgamaslnpyvkagkfkp
    fsgntdlvpgikalashghtpghttyvvesqgqklallgdlilvaavqfddpsvttqlds
    dsksvaverkkafadaakggyliaashlsfpgighiraegkgyrfvpvnysvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p9eB (B:)
    mplknrllarlscvaavvaataavapltlvstahaaapqvrtsapgyyrmllgdfeital
    sdgtvalpvdkrlnqpapktqsalaksfqkapletsvtgylvntgsklvlvdtgaaglfg
    ptlgrlaanlkaagyqpeqvdeiyithmhpdhvgglmvgeqlafpnavvradqkeadfwl
    sqtnldkapddeskgffkgamaslnpyvkagkfkpfsgntdlvpgikalashghtpghtt
    yvvesqgqklallgdlilvaavqfddpsvttqldsdsksvaverkkafadaakggyliaa
    shlsfpgighiraegkgyrfvpvnysvvnpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p9eB (B:)
    aapqvrtsapgyyrmllgdfeitalsdgtvalpvdkrlnqpapktqsalaksfqkaplet
    svtgylvntgsklvlvdtgaaglfgptlgrlaanlkaagyqpeqvdeiyithmhpdhvgg
    lmvgeqlafpnavvradqkeadfwlsqtnldkapddeskgffkgamaslnpyvkagkfkp
    fsgntdlvpgikalashghtpghttyvvesqgqklallgdlilvaavqfddpsvttqlds
    dsksvaverkkafadaakggyliaashlsfpgighiraegkgyrfvpvnysvvn