PDB entry 1p9d

View 1p9d on RCSB PDB site
Description: high-resolution structure of the complex of hhr23a ubiquitin-like domain and the c-terminal ubiquitin-interacting motif of proteasome subunit s5a
Deposited on 2003-05-10, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Domains in SCOP 1.67: d1p9ds_
  • Chain 'U':
    Domains in SCOP 1.67: d1p9du_

PDB Chain Sequences:

  • Chain 'S':
    Sequence, based on SEQRES records: (download) 
    >1p9dS (S:)
mtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad

    Sequence, based on observed residues (ATOM records): (download) 
    >1p9dS (S:)
fgrtglpdlssmteeeqiayamqmslqgaefg

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p9dU (U:)
mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvtk