PDB entry 1p9d

View 1p9d on RCSB PDB site
Description: High-resolution structure of the complex of HHR23A ubiquitin-like domain and the C-terminal ubiquitin-interacting motif of proteasome subunit S5a
Class: replication
Keywords: protein-peptide complex, REPLICATION
Deposited on 2003-05-10, released 2003-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'S':
  Compound: 26S proteasome non-ATPase regulatory subunit 4
  Species: Homo sapiens [TaxId:9606]
  Gene: PSMD4 OR MCB1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55036
  Domains in SCOPe 2.08: d1p9ds_
• Chain 'U':
  Compound: uv excision repair protein rad23 homolog a
  Species: Homo sapiens [TaxId:9606]
  Gene: RAD23A
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54725 (0-77)
  Domains in SCOPe 2.08: d1p9du_

PDB Chain Sequences:

• Chain 'S':
  Sequence, based on SEQRES records: (download)
  

  >1p9dS (S:)
  mtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1p9dS (S:)
  fgrtglpdlssmteeeqiayamqmslqgaefg
  

  
  
• Chain 'U':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p9dU (U:)
  mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
  irdyrideknfvvvmvtk