PDB entry 1p9c

View 1p9c on RCSB PDB site
Description: nmr solution structure of the c-terminal ubiquitin-interacting motif of the proteasome subunit s5a
Deposited on 2003-05-10, released 2003-10-07
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1p9ca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p9cA (A:)
  mtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad