PDB entry 1p98

View 1p98 on RCSB PDB site
Description: high-resolution nmr structure of the ubl-domain of hhr23a
Deposited on 2003-05-09, released 2003-10-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1p98a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p98A (A:)
  mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
  irdyrideknfvvvmvtk