PDB entry 1p97

View 1p97 on RCSB PDB site
Description: NMR structure of the C-terminal PAS domain of HIF2a
Class: transcription
Keywords: Mixed alpha-beta fold, TRANSCRIPTION
Deposited on 2003-05-09, released 2004-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial PAS domain protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99814 (3-113)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1p97a1, d1p97a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p97A (A:)
    gamdsktflsrhsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnl
    ctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn